SCOPe 2.08: Domain d5f3hb2: 5f3h B:107-213

Lineage for d5f3hb2 (5f3h B:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5f3hb2: 5f3h B:107-213 [323501]
   Other proteins in same PDB: d5f3ha_, d5f3hb1, d5f3hc_, d5f3hd1, d5f3he_, d5f3hf1, d5f3hg_, d5f3hh1, d5f3hi_, d5f3hj_, d5f3hk_, d5f3hl_
   automated match to d1dn0a2

Details for d5f3hb2

PDB Entry: 5f3h, 2.7 Å

PDB Description: structure of myostatin in complex with humanized rk35 antibody

PDB Compounds: (B:) humanized RK35 antibody light chain

SCOPe Domain Sequences for d5f3hb2:

Sequence; same for both SEQRES and ATOM records:

>d5f3hb2 b.1.1.2 (B:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5f3hb2:

• d5f3hb2 first appeared in SCOPe 2.06
  
• d5f3hb2 appears in SCOPe 2.07