Lineage for d5ds1b1 (5ds1 B:3-94)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773837Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773838Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2773941Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 2773942Protein automated matches [191181] (10 species)
    not a true protein
  7. 2773954Species Pea (Pisum sativum) [TaxId:3888] [323226] (1 PDB entry)
  8. 2773956Domain d5ds1b1: 5ds1 B:3-94 [323489]
    Other proteins in same PDB: d5ds1a2, d5ds1b2, d5ds1c2
    automated match to d2h50a1

Details for d5ds1b1

PDB Entry: 5ds1 (more details), 2.63 Å

PDB Description: core domain of the class ii small heat-shock protein hsp 17.7 from pisum sativum
PDB Compounds: (B:) 17.1 kDa class II heat shock protein

SCOPe Domain Sequences for d5ds1b1:

Sequence, based on SEQRES records: (download)

>d5ds1b1 b.15.1.0 (B:3-94) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
tpadvkehpnsyvfmvdmpgvksgdikvqvedenvllisgerkreeekegvkylkmerri
gklmrkfvlpenanieaisaisqdgvltvtvn

Sequence, based on observed residues (ATOM records): (download)

>d5ds1b1 b.15.1.0 (B:3-94) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
tpadvkehpnsyvfmvdmpgvksgdikvqvedenvllisgerkrekegvkylkmerrigk
lmrkfvlpennieaisaisqdgvltvtvn

SCOPe Domain Coordinates for d5ds1b1:

Click to download the PDB-style file with coordinates for d5ds1b1.
(The format of our PDB-style files is described here.)

Timeline for d5ds1b1: