SCOPe 2.08: Domain d5dpta_: 5dpt A:

Lineage for d5dpta_ (5dpt A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)

8. Domain d5dpta_: 5dpt A: [323484]
   automated match to d3wanb_
   complexed with mpd

Details for d5dpta_

PDB Entry: 5dpt, 2.9 Å

PDB Description: crystal structure of plekhm1 lir-fused human gabarapl1_2-117

PDB Compounds: (A:) Pleckstrin homology domain-containing family M member 1, Gamma-aminobutyric acid receptor-associated protein-like 1,Gamma-aminobutyric acid receptor-associated protein-like 1

SCOPe Domain Sequences for d5dpta_:

Sequence; same for both SEQRES and ATOM records:

>d5dpta_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edewvnvgskfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvp
sdltvgqfyflirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysde
sv

Timeline for d5dpta_:

• d5dpta_ first appeared in SCOPe 2.06
  
• d5dpta_ appears in SCOPe 2.07