![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (9 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [52679] (9 PDB entries) |
![]() | Domain d1efre3: 1efr E:82-357 [32348] Other proteins in same PDB: d1efra1, d1efra2, d1efrb1, d1efrb2, d1efrc1, d1efrc2, d1efrd1, d1efrd2, d1efre1, d1efre2, d1efrf1, d1efrf2, d1efrg_ |
PDB Entry: 1efr (more details), 3.1 Å
SCOP Domain Sequences for d1efre3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efre3 c.37.1.11 (E:82-357) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d1efre3: