Lineage for d5jcze_ (5jcz E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2011440Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2011441Family a.118.27.1: DIL domains from class V myosins [310651] (6 proteins)
  6. 2011472Protein automated matches [310888] (2 species)
    not a true protein
  7. 2011475Species Human (Homo sapiens) [TaxId:9606] [311399] (4 PDB entries)
  8. 2011480Domain d5jcze_: 5jcz E: [323475]
    Other proteins in same PDB: d5jcza_, d5jczd_, d5jczi_
    automated match to d4lwzb_
    complexed with act, bef, edo, gdp, gol, mg

Details for d5jcze_

PDB Entry: 5jcz (more details), 2.06 Å

PDB Description: rab11 bound to myova-gtd
PDB Compounds: (E:) Unconventional myosin-Va

SCOPe Domain Sequences for d5jcze_:

Sequence, based on SEQRES records: (download)

>d5jcze_ a.118.27.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrsl
ltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehcltn
fdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgvsgvkptglrkrtss
iadegtytldsilrqlnsfhsvmcqhgmdpelikqvvkqmfyiigaitlnnlllrkdmcs
wskgmqirynvsqleewlrdknlmnsgaketlepliqaaqllqvkkktdddaeaicsmcn
alttaqivkvlnlytpvnefeervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfn
psslaletiqipaslglgfisrv

Sequence, based on observed residues (ATOM records): (download)

>d5jcze_ a.118.27.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrsl
ltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehcltn
fdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetgtytldsilrqlnsfhsv
mcqhgmdpelikqvvkqmfyiigaitlnnlllrkdmcswskgmqirynvsqleewlrdkn
lmnsgaketlepliqaaqllqvkkktdddaeaicsmcnalttaqivkvlnlytpvnefee
rvsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfnpsslaletiqipaslglgfisr
v

SCOPe Domain Coordinates for d5jcze_:

Click to download the PDB-style file with coordinates for d5jcze_.
(The format of our PDB-style files is described here.)

Timeline for d5jcze_: