Lineage for d2n7ya1 (2n7y A:5-76)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2520807Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2520941Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 2520942Protein automated matches [191063] (8 species)
    not a true protein
  7. 2520948Species Human (Homo sapiens) [TaxId:9606] [254969] (11 PDB entries)
  8. 2520949Domain d2n7ya1: 2n7y A:5-76 [323471]
    Other proteins in same PDB: d2n7ya2
    automated match to d1kvja_

Details for d2n7ya1

PDB Entry: 2n7y (more details)

PDB Description: nmr structure of metal-binding domain 1 of atp7b
PDB Compounds: (A:) Copper-transporting ATPase 2

SCOPe Domain Sequences for d2n7ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n7ya1 d.58.17.0 (A:5-76) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvatstvrilgmtcqscvksiedrisnlkgiismkvsleqgsatvkyvpsvvclqqvchq
igdmgfeasiae

SCOPe Domain Coordinates for d2n7ya1:

Click to download the PDB-style file with coordinates for d2n7ya1.
(The format of our PDB-style files is described here.)

Timeline for d2n7ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2n7ya2