Lineage for d5lvka_ (5lvk A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2531389Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2531455Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2532460Species Human (Homo sapiens) [TaxId:9606] [53969] (203 PDB entries)
    Uniprot P00695
  8. 2532680Domain d5lvka_: 5lvk A: [323462]
    automated match to d1jsfa_
    complexed with cl, na, no3, ru, so4

Details for d5lvka_

PDB Entry: 5lvk (more details), 2.49 Å

PDB Description: human lysozyme soaked with [h2ind][trans-rucl4(dmso)(hind)]
PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d5lvka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lvka_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOPe Domain Coordinates for d5lvka_:

Click to download the PDB-style file with coordinates for d5lvka_.
(The format of our PDB-style files is described here.)

Timeline for d5lvka_: