Lineage for d1efrc3 (1efr C:95-379)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243788Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (9 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 243841Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)
  7. 243845Species Cow (Bos taurus) [TaxId:9913] [52679] (9 PDB entries)
  8. 243884Domain d1efrc3: 1efr C:95-379 [32346]
    Other proteins in same PDB: d1efra1, d1efra2, d1efrb1, d1efrb2, d1efrc1, d1efrc2, d1efrd1, d1efrd2, d1efre1, d1efre2, d1efrf1, d1efrf2, d1efrg_

Details for d1efrc3

PDB Entry: 1efr (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efrc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efrc3 c.37.1.11 (C:95-379) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOP Domain Coordinates for d1efrc3:

Click to download the PDB-style file with coordinates for d1efrc3.
(The format of our PDB-style files is described here.)

Timeline for d1efrc3: