SCOPe 2.06: Domain d5f3bd_: 5f3b D:

Lineage for d5f3bd_ (5f3b D:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188989] (6 PDB entries)

8. Domain d5f3bd_: 5f3b D: [323449]
   Other proteins in same PDB: d5f3bb1, d5f3bb2, d5f3bf1, d5f3bf2
   automated match to d3hh2a_
   complexed with gol

Details for d5f3bd_

PDB Entry: 5f3b, 1.76 Å

PDB Description: structure of myostatin in complex with chimeric rk35 antibody

PDB Compounds: (D:) Growth/differentiation factor 8

SCOPe Domain Sequences for d5f3bd_:

Sequence, based on SEQRES records:

>d5f3bd_ g.17.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthl
vhqanprgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs

Sequence, based on observed residues (ATOM records):

>d5f3bd_ g.17.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dfgldcdeccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthlvhqanp
rgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs

Timeline for d5f3bd_:

• d5f3bd_ is new in SCOPe 2.06-stable
  
• d5f3bd_ appears in SCOPe 2.07
  
• d5f3bd_ appears in the current release, SCOPe 2.08