Lineage for d5f3bd_ (5f3b D:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033932Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 3033933Protein automated matches [190506] (3 species)
    not a true protein
  7. 3033934Species Human (Homo sapiens) [TaxId:9606] [187459] (39 PDB entries)
  8. 3033949Domain d5f3bd_: 5f3b D: [323449]
    Other proteins in same PDB: d5f3ba_, d5f3bb1, d5f3bb2, d5f3be_, d5f3bf1, d5f3bf2
    automated match to d3hh2a_
    complexed with gol

Details for d5f3bd_

PDB Entry: 5f3b (more details), 1.76 Å

PDB Description: structure of myostatin in complex with chimeric rk35 antibody
PDB Compounds: (D:) Growth/differentiation factor 8

SCOPe Domain Sequences for d5f3bd_:

Sequence, based on SEQRES records: (download)

>d5f3bd_ g.17.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthl
vhqanprgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs

Sequence, based on observed residues (ATOM records): (download)

>d5f3bd_ g.17.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfgldcdeccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthlvhqanp
rgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs

SCOPe Domain Coordinates for d5f3bd_:

Click to download the PDB-style file with coordinates for d5f3bd_.
(The format of our PDB-style files is described here.)

Timeline for d5f3bd_: