Lineage for d1efra3 (1efr A:95-379)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1364615Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1364671Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)
  7. 1364674Species Cow (Bos taurus) [TaxId:9913] [88775] (15 PDB entries)
    Uniprot P19483
  8. 1364708Domain d1efra3: 1efr A:95-379 [32344]
    Other proteins in same PDB: d1efra1, d1efra2, d1efrb1, d1efrb2, d1efrc1, d1efrc2, d1efrd1, d1efrd2, d1efrd3, d1efre1, d1efre2, d1efre3, d1efrf1, d1efrf2, d1efrf3, d1efrg_
    complexed with adp, anp, mg

Details for d1efra3

PDB Entry: 1efr (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin
PDB Compounds: (A:) bovine mitochondrial f1-ATPase subunit alpha

SCOPe Domain Sequences for d1efra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efra3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOPe Domain Coordinates for d1efra3:

Click to download the PDB-style file with coordinates for d1efra3.
(The format of our PDB-style files is described here.)

Timeline for d1efra3: