Lineage for d1efra3 (1efr A:95-379)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins)
  6. 23531Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (3 species)
  7. 23535Species Cow (Bos taurus) [TaxId:9913] [52679] (7 PDB entries)
  8. 23566Domain d1efra3: 1efr A:95-379 [32344]
    Other proteins in same PDB: d1efra1, d1efra2, d1efrb1, d1efrb2, d1efrc1, d1efrc2, d1efrd1, d1efrd2, d1efre1, d1efre2, d1efrf1, d1efrf2, d1efrg_

Details for d1efra3

PDB Entry: 1efr (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efra3 c.37.1.11 (A:95-379) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOP Domain Coordinates for d1efra3:

Click to download the PDB-style file with coordinates for d1efra3.
(The format of our PDB-style files is described here.)

Timeline for d1efra3: