Lineage for d1e1qf3 (1e1q F:82-357)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70095Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins)
  6. 70110Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)
  7. 70114Species Cow (Bos taurus) [TaxId:9913] [52679] (9 PDB entries)
  8. 70144Domain d1e1qf3: 1e1q F:82-357 [32343]
    Other proteins in same PDB: d1e1qa1, d1e1qa2, d1e1qb1, d1e1qb2, d1e1qc1, d1e1qc2, d1e1qd1, d1e1qd2, d1e1qe1, d1e1qe2, d1e1qf1, d1e1qf2, d1e1qg_

Details for d1e1qf3

PDB Entry: 1e1q (more details), 2.61 Å

PDB Description: bovine mitochondrial f1-atpase at 100k

SCOP Domain Sequences for d1e1qf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1qf3 c.37.1.11 (F:82-357) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOP Domain Coordinates for d1e1qf3:

Click to download the PDB-style file with coordinates for d1e1qf3.
(The format of our PDB-style files is described here.)

Timeline for d1e1qf3: