Lineage for d1e1qf3 (1e1q F:82-357)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869554Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)
  7. 2869603Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
    Uniprot P00829
  8. 2869654Domain d1e1qf3: 1e1q F:82-357 [32343]
    Other proteins in same PDB: d1e1qa1, d1e1qa2, d1e1qa3, d1e1qb1, d1e1qb2, d1e1qb3, d1e1qc1, d1e1qc2, d1e1qc3, d1e1qd1, d1e1qd2, d1e1qe1, d1e1qe2, d1e1qf1, d1e1qf2, d1e1qg_
    complexed with adp, anp, mg, po4

Details for d1e1qf3

PDB Entry: 1e1q (more details), 2.61 Å

PDB Description: bovine mitochondrial f1-atpase at 100k
PDB Compounds: (F:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1e1qf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1qf3 c.37.1.11 (F:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOPe Domain Coordinates for d1e1qf3:

Click to download the PDB-style file with coordinates for d1e1qf3.
(The format of our PDB-style files is described here.)

Timeline for d1e1qf3: