SCOPe 2.07: Domain d5f3bb2: 5f3b B:107-213

Lineage for d5f3bb2 (5f3b B:107-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d5f3bb2: 5f3b B:107-213 [323425]
   Other proteins in same PDB: d5f3bb1, d5f3bc_, d5f3bd_, d5f3bf1
   automated match to d1dn0a2
   complexed with gol

Details for d5f3bb2

PDB Entry: 5f3b, 1.76 Å

PDB Description: structure of myostatin in complex with chimeric rk35 antibody

PDB Compounds: (B:) RK35 Chimeric antibody light chain

SCOPe Domain Sequences for d5f3bb2:

Sequence; same for both SEQRES and ATOM records:

>d5f3bb2 b.1.1.2 (B:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5f3bb2:

• d5f3bb2 first appeared in SCOPe 2.06
  
• d5f3bb2 appears in the current release, SCOPe 2.08