Class b: All beta proteins [48724] (180 folds) |
Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) |
Family b.15.1.1: HSP20 [49765] (2 proteins) |
Protein automated matches [323218] (1 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [323219] (1 PDB entry) |
Domain d5ds2c_: 5ds2 C: [323423] automated match to d2h50a1 complexed with so4 |
PDB Entry: 5ds2 (more details), 1.85 Å
SCOPe Domain Sequences for d5ds2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ds2c_ b.15.1.1 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} strvdwketpeahvfkadlpglkkeevkveveddrvlqisgersvekedkndewhrvers sgkflrrfrlpenakmdkvkasmengvltvtvpk
Timeline for d5ds2c_: