SCOP 1.57: Domain d1e1qe3: 1e1q E:82-357

Lineage for d1e1qe3 (1e1q E:82-357)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins)

6. Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52679] (9 PDB entries)

8. Domain d1e1qe3: 1e1q E:82-357 [32342]
   Other proteins in same PDB: d1e1qa1, d1e1qa2, d1e1qb1, d1e1qb2, d1e1qc1, d1e1qc2, d1e1qd1, d1e1qd2, d1e1qe1, d1e1qe2, d1e1qf1, d1e1qf2, d1e1qg_

Details for d1e1qe3

PDB Entry: 1e1q, 2.61 Å

PDB Description: bovine mitochondrial f1-atpase at 100k

SCOP Domain Sequences for d1e1qe3:

Sequence; same for both SEQRES and ATOM records:

>d1e1qe3 c.37.1.11 (E:82-357) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

Timeline for d1e1qe3:

• d1e1qe3 first appeared (with stable ids) in SCOP 1.55
  
• d1e1qe3 appears in SCOP 1.59
  
• d1e1qe3 appears in the current release, SCOPe 2.08