Lineage for d5faub_ (5fau B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110701Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2110702Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2110795Family c.7.1.0: automated matches [275322] (1 protein)
    not a true family
  6. 2110796Protein automated matches [275324] (2 species)
    not a true protein
  7. 2110797Species Desulfovibrio alaskensis [TaxId:207559] [323257] (5 PDB entries)
  8. 2110805Domain d5faub_: 5fau B: [323412]
    automated match to d5a0uh_
    complexed with cht, gol

Details for d5faub_

PDB Entry: 5fau (more details), 1.9 Å

PDB Description: wild-type choline tma lyase in complex with choline
PDB Compounds: (B:) Choline trimethylamine-lyase

SCOPe Domain Sequences for d5faub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5faub_ c.7.1.0 (B:) automated matches {Desulfovibrio alaskensis [TaxId: 207559]}
sgipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfrycceta
plviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlree
vfpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgml
diqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprr
kaelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyra
didsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdat
ndltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmm
lakgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtp
dmgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesg
rdvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqi
ladclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllg
asangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtp
egenglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelck
dvqdeiisrtmlhgf

SCOPe Domain Coordinates for d5faub_:

Click to download the PDB-style file with coordinates for d5faub_.
(The format of our PDB-style files is described here.)

Timeline for d5faub_: