Lineage for d5jqug_ (5jqu G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331061Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. 2331062Species Bacillus megaterium [TaxId:1348623] [342557] (7 PDB entries)
  8. 2331075Domain d5jqug_: 5jqu G: [323405]
    automated match to d2uwha_
    complexed with fde

Details for d5jqug_

PDB Entry: 5jqu (more details), 2.16 Å

PDB Description: crystal structure of cytochrome p450 bm3 heme domain g265f/t269v/l272w/l322i/f405m/a406s (wivs-fm) variant with iron(iii) deuteroporphyrin ix bound
PDB Compounds: (G:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d5jqug_:

Sequence, based on SEQRES records: (download)

>d5jqug_ a.104.1.1 (G:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1348623]}
ikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikea
cdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvd
iavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvral
deamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngk
dpetgeplddeniryqiitfliafhetvsgwlsfalyflvknphvlqkaaeeaarvlvdp
vpsykqvkqlkyvgmvlneairlwptapafslyakedtvlggeyplekgdelmvlipqlh
rdktiwgddveefrperfenpsaipqhafkpfgngqracigqqmslheatlvlgmmlkhf
dfedhtnyeldiketltlkpegfvvkakskkipl

Sequence, based on observed residues (ATOM records): (download)

>d5jqug_ a.104.1.1 (G:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1348623]}
ikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikea
cdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvd
iavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvral
deamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkaqsddllthmlngkdpe
tgeplddeniryqiitfliafhetvsgwlsfalyflvknphvlqkaaeeaarvlvdpvps
ykqvkqlkyvgmvlneairlwptapafslyakedtvlggeyplekgdelmvlipqlhrdk
tiwgddveefrperfenpsaipqhafkpfgngqracigqqmslheatlvlgmmlkhfdfe
dhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d5jqug_:

Click to download the PDB-style file with coordinates for d5jqug_.
(The format of our PDB-style files is described here.)

Timeline for d5jqug_: