![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein automated matches [190140] (37 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [323396] (2 PDB entries) |
![]() | Domain d5dt6a1: 5dt6 A:3-266 [323397] Other proteins in same PDB: d5dt6a2 automated match to d5ftia_ complexed with glu, gol |
PDB Entry: 5dt6 (more details), 1.6 Å
SCOPe Domain Sequences for d5dt6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dt6a1 c.94.1.1 (A:3-266) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ydrnhtyivsslleepylslkqytygeslvgndrfegyckdladmlaaqlgikyeirlvq dgnygaenqyapggwdgmvgelirkeadiaisamtitaerervidfskpfmtlgisimik kgtpiktpedltmqtdvnygtllygstweffrrsqiglhnkmweymnanqhhsvhtydeg irrvrqskgkyallvespkneyvnarppcdtmkvgrnidtkgfgvatpigsplrkrlnea vltlkengellrirnkwwfdktec
Timeline for d5dt6a1: