Lineage for d5f3hi_ (5f3h I:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260706Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2260707Protein automated matches [190506] (3 species)
    not a true protein
  7. 2260750Species Mouse (Mus musculus) [TaxId:10090] [188989] (6 PDB entries)
  8. 2260760Domain d5f3hi_: 5f3h I: [323391]
    Other proteins in same PDB: d5f3hb1, d5f3hb2, d5f3hd1, d5f3hd2, d5f3hf1, d5f3hf2, d5f3hh1, d5f3hh2
    automated match to d3hh2a_

Details for d5f3hi_

PDB Entry: 5f3h (more details), 2.7 Å

PDB Description: structure of myostatin in complex with humanized rk35 antibody
PDB Compounds: (I:) Growth/differentiation factor 8

SCOPe Domain Sequences for d5f3hi_:

Sequence, based on SEQRES records: (download)

>d5f3hi_ g.17.1.0 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthlv
hqanprgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs

Sequence, based on observed residues (ATOM records): (download)

>d5f3hi_ g.17.1.0 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fgldcdesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthlvhqan
prgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs

SCOPe Domain Coordinates for d5f3hi_:

Click to download the PDB-style file with coordinates for d5f3hi_.
(The format of our PDB-style files is described here.)

Timeline for d5f3hi_: