Lineage for d5jqub_ (5jqu B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007940Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2007941Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2007942Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2008494Protein automated matches [190068] (9 species)
    not a true protein
  7. 2008495Species Bacillus megaterium [TaxId:1348623] [323366] (4 PDB entries)
  8. 2008501Domain d5jqub_: 5jqu B: [323367]
    automated match to d2uwha_
    complexed with fde

Details for d5jqub_

PDB Entry: 5jqu (more details), 2.16 Å

PDB Description: crystal structure of cytochrome p450 bm3 heme domain g265f/t269v/l272w/l322i/f405m/a406s (wivs-fm) variant with iron(iii) deuteroporphyrin ix bound
PDB Compounds: (B:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d5jqub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jqub_ a.104.1.1 (B:) automated matches {Bacillus megaterium [TaxId: 1348623]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
petgeplddeniryqiitfliafhetvsgwlsfalyflvknphvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlneairlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpfgngqracigqqmslheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d5jqub_:

Click to download the PDB-style file with coordinates for d5jqub_.
(The format of our PDB-style files is described here.)

Timeline for d5jqub_: