SCOPe 2.08: Domain d5eu7b_: 5eu7 B:

Lineage for d5eu7b_ (5eu7 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
   Pfam PF00665

6. Protein Retroviral integrase, catalytic domain [53108] (5 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries)

8. Domain d5eu7b_: 5eu7 B: [323362]
   Other proteins in same PDB: d5eu7c1, d5eu7c2, d5eu7d1, d5eu7d2, d5eu7e_, d5eu7f_
   automated match to d1bisa_

Details for d5eu7b_

PDB Entry: 5eu7, 2.64 Å

PDB Description: crystal structure of hiv-1 integrase catalytic core in complex with fab

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d5eu7b_:

Sequence, based on SEQRES records:

>d5eu7b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktihtd
ngsnftsttvkaacdwagikqefgipynpqsqgvvesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d5eu7b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktihtd
ngsnftsttvkaacdwagikqefgvvesmnkelkkiigqvrdqaehlktavqmavfihnk
krkggiggysagerivdiiatdiq

Timeline for d5eu7b_:

• d5eu7b_ first appeared in SCOPe 2.06
  
• d5eu7b_ appears in SCOPe 2.07