| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (14 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
| Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88780] (12 PDB entries) |
| Domain d1nbmd3: 1nbm D:82-357 [32335] Other proteins in same PDB: d1nbma1, d1nbma2, d1nbma3, d1nbmb1, d1nbmb2, d1nbmb3, d1nbmc1, d1nbmc2, d1nbmc3, d1nbmd1, d1nbmd2, d1nbme1, d1nbme2, d1nbmf1, d1nbmf2, d1nbmg_ |
PDB Entry: 1nbm (more details), 3 Å
SCOP Domain Sequences for d1nbmd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbmd3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d1nbmd3: