SCOPe 2.08: Domain d1nbmd3: 1nbm D:82-357

Lineage for d1nbmd3 (1nbm D:82-357)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
   Uniprot P00829

8. Domain d1nbmd3: 1nbm D:82-357 [32335]
   Other proteins in same PDB: d1nbma1, d1nbma2, d1nbma3, d1nbmb1, d1nbmb2, d1nbmb3, d1nbmc1, d1nbmc2, d1nbmc3, d1nbmd1, d1nbmd2, d1nbme1, d1nbme2, d1nbmf1, d1nbmf2, d1nbmg_
   complexed with adp, atp, mg, po4

Details for d1nbmd3

PDB Entry: 1nbm, 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

PDB Compounds: (D:) f1-ATPase

SCOPe Domain Sequences for d1nbmd3:

Sequence; same for both SEQRES and ATOM records:

>d1nbmd3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

Timeline for d1nbmd3:

• d1nbmd3 first appeared (with stable ids) in SCOP 1.55
  
• d1nbmd3 appears in SCOPe 2.07