Lineage for d5fava1 (5fav A:53-846)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434269Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2434270Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2434363Family c.7.1.0: automated matches [275322] (1 protein)
    not a true family
  6. 2434364Protein automated matches [275324] (3 species)
    not a true protein
  7. 2434368Species Desulfovibrio alaskensis [TaxId:207559] [323257] (5 PDB entries)
  8. 2434369Domain d5fava1: 5fav A:53-846 [323342]
    Other proteins in same PDB: d5fava2, d5favb2
    automated match to d5a0uh_
    complexed with mli, na; mutant

Details for d5fava1

PDB Entry: 5fav (more details), 1.6 Å

PDB Description: e491q mutant of choline tma-lyase
PDB Compounds: (A:) Choline trimethylamine-lyase

SCOPe Domain Sequences for d5fava1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fava1 c.7.1.0 (A:53-846) automated matches {Desulfovibrio alaskensis [TaxId: 207559]}
gipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetap
lviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreev
fpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmld
iqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrk
aelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyrad
idsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatn
dltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmml
akgvsiedardyclmgcvqpqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpd
mgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgr
dvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqil
adclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllga
sangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpe
genglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckd
vqdeiisrtmlhgf

SCOPe Domain Coordinates for d5fava1:

Click to download the PDB-style file with coordinates for d5fava1.
(The format of our PDB-style files is described here.)

Timeline for d5fava1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fava2