Lineage for d5ds2a_ (5ds2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773837Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773838Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2773839Family b.15.1.1: HSP20 [49765] (2 proteins)
  6. 2773913Protein automated matches [323218] (1 species)
    not a true protein
  7. 2773914Species Pea (Pisum sativum) [TaxId:3888] [323219] (1 PDB entry)
  8. 2773915Domain d5ds2a_: 5ds2 A: [323325]
    automated match to d2h50a1
    complexed with so4

Details for d5ds2a_

PDB Entry: 5ds2 (more details), 1.85 Å

PDB Description: core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum
PDB Compounds: (A:) 18.1 kDa class I heat shock protein

SCOPe Domain Sequences for d5ds2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ds2a_ b.15.1.1 (A:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
strvdwketpeahvfkadlpglkkeevkveveddrvlqisgersvekedkndewhrvers
sgkflrrfrlpenakmdkvkasmengvltvtvpk

SCOPe Domain Coordinates for d5ds2a_:

Click to download the PDB-style file with coordinates for d5ds2a_.
(The format of our PDB-style files is described here.)

Timeline for d5ds2a_: