Lineage for d5ac7a_ (5ac7 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090271Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2091023Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2091024Protein automated matches [190292] (34 species)
    not a true protein
  7. 2091219Species Salmonella enterica [TaxId:28901] [276471] (19 PDB entries)
  8. 2091231Domain d5ac7a_: 5ac7 A: [323319]
    automated match to d5a5wa_
    complexed with gol, na, so4; mutant

Details for d5ac7a_

PDB Entry: 5ac7 (more details), 1.9 Å

PDB Description: s. enterica hisa with mutations d7n, d10g, dup13-15

SCOPe Domain Sequences for d5ac7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ac7a_ c.1.2.0 (A:) automated matches {Salmonella enterica [TaxId: 28901]}
miipalnliggtvvrvvrlhqgdyarqrdygndplprlqdyaaqgagvlhlvdltgakdp
akrqipliktlvagvnvpvqvgggvrteedvaallkagvarvvigstavkspdvvkgwfe
rfgaqalvlaldvridehgtkqvavsgwqensgvsleqlvetylpvglkhvlctdisrdg
tlagsnvslyeevcarypqiafqssggigdiddiaalrgtgvrgvivgrallegkftvke
aiqcwq

SCOPe Domain Coordinates for d5ac7a_:

Click to download the PDB-style file with coordinates for d5ac7a_.
(The format of our PDB-style files is described here.)

Timeline for d5ac7a_: