| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) ![]() contains 2Fe-2S cluster |
| Family a.56.1.0: automated matches [227241] (1 protein) not a true family |
| Protein automated matches [227007] (6 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [323304] (2 PDB entries) |
| Domain d5g5ga2: 5g5g A:139-226 [323318] Other proteins in same PDB: d5g5ga1 automated match to d1qj2a4 complexed with act, cl, fad, fes, gol, iod, mcn, mos, sf4 |
PDB Entry: 5g5g (more details), 1.7 Å
SCOPe Domain Sequences for d5g5ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g5ga2 a.56.1.0 (A:139-226) automated matches {Escherichia coli [TaxId: 83333]}
spdnlhpmqaafikhdgfqcgyctsgqicssvavlkeiqdgipshvtvdlvsapettade
irermsgnicrcgayanilaaiedaage
Timeline for d5g5ga2: