Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (21 species) not a true protein |
Species Escherichia coli [TaxId:83333] [323302] (2 PDB entries) |
Domain d5g5ga1: 5g5g A:52-138 [323317] Other proteins in same PDB: d5g5ga2 automated match to d1n62a2 complexed with act, cl, fad, fes, gol, iod, mcn, mos, sf4 |
PDB Entry: 5g5g (more details), 1.7 Å
SCOPe Domain Sequences for d5g5ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g5ga1 d.15.4.0 (A:52-138) automated matches {Escherichia coli [TaxId: 83333]} paatpapeimpltlkvngkteqlevdtrttlldtlrenlhligtkkgcdhgqcgactvlv ngrrlnacltlavmhqgaeittieglg
Timeline for d5g5ga1: