Lineage for d5g5ga1 (5g5g A:52-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2934202Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2934203Protein automated matches [191164] (24 species)
    not a true protein
  7. 2934246Species Escherichia coli [TaxId:83333] [323302] (2 PDB entries)
  8. 2934247Domain d5g5ga1: 5g5g A:52-138 [323317]
    Other proteins in same PDB: d5g5ga2
    automated match to d1n62a2
    complexed with act, cl, fad, fes, gol, iod, mcn, mos, sf4

Details for d5g5ga1

PDB Entry: 5g5g (more details), 1.7 Å

PDB Description: escherichia coli periplasmic aldehyde oxidase
PDB Compounds: (A:) putative xanthine dehydrogenase yagt iron-sulfur-binding subunit

SCOPe Domain Sequences for d5g5ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5ga1 d.15.4.0 (A:52-138) automated matches {Escherichia coli [TaxId: 83333]}
paatpapeimpltlkvngkteqlevdtrttlldtlrenlhligtkkgcdhgqcgactvlv
ngrrlnacltlavmhqgaeittieglg

SCOPe Domain Coordinates for d5g5ga1:

Click to download the PDB-style file with coordinates for d5g5ga1.
(The format of our PDB-style files is described here.)

Timeline for d5g5ga1: