![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d5f3hf1: 5f3h F:1-106 [323312] Other proteins in same PDB: d5f3ha_, d5f3hb2, d5f3hc_, d5f3hd2, d5f3he_, d5f3hf2, d5f3hg_, d5f3hh2, d5f3hi_, d5f3hj_, d5f3hk_, d5f3hl_ automated match to d1dn0a1 |
PDB Entry: 5f3h (more details), 2.7 Å
SCOPe Domain Sequences for d5f3hf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f3hf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} diqmtqspsslsasvgdrvtitckasqdvstavawyqqkpgkapklliysasyrytgvps rfsgsgsgtdftltisslnpedfatyycqqhystpwtfgggtkvei
Timeline for d5f3hf1: