Lineage for d5dpsc_ (5dps C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933260Domain d5dpsc_: 5dps C: [323308]
    automated match to d3wanb_

Details for d5dpsc_

PDB Entry: 5dps (more details), 2 Å

PDB Description: crystal structure of plekhm1 lir-fused human gabarap_2-117
PDB Compounds: (C:) Pleckstrin homology domain-containing family M member 1,Gamma-aminobutyric acid receptor-associated protein

SCOPe Domain Sequences for d5dpsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dpsc_ d.15.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dewvnvgskfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvps
dltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdes
v

SCOPe Domain Coordinates for d5dpsc_:

Click to download the PDB-style file with coordinates for d5dpsc_.
(The format of our PDB-style files is described here.)

Timeline for d5dpsc_: