SCOPe 2.08: Domain d5g5ha2: 5g5h A:139-225

Lineage for d5g5ha2 (5g5h A:139-225)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.0: automated matches [227241] (1 protein)
   not a true family

6. Protein automated matches [227007] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [323304] (2 PDB entries)

8. Domain d5g5ha2: 5g5h A:139-225 [323305]
   Other proteins in same PDB: d5g5ha1
   automated match to d1qj2a4
   complexed with act, cl, csd, fad, fes, gol, iod, mcn, mos, sf4; mutant

Details for d5g5ha2

PDB Entry: 5g5h, 2.3 Å

PDB Description: escherichia coli periplasmic aldehyde oxidase r440h mutant

PDB Compounds: (A:) putative xanthine dehydrogenase yagt iron-sulfur-binding subunit

SCOPe Domain Sequences for d5g5ha2:

Sequence; same for both SEQRES and ATOM records:

>d5g5ha2 a.56.1.0 (A:139-225) automated matches {Escherichia coli [TaxId: 83333]}
spdnlhpmqaafikhdgfqcgyctsgqicssvavlkeiqdgipshvtvdlvsapettade
irermsgnicrcgayanilaaiedaag

Timeline for d5g5ha2:

• d5g5ha2 first appeared in SCOPe 2.06
  
• d5g5ha2 appears in SCOPe 2.07