SCOPe 2.08: Domain d5g5ha1: 5g5h A:53-138

Lineage for d5g5ha1 (5g5h A:53-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [323302] (2 PDB entries)

8. Domain d5g5ha1: 5g5h A:53-138 [323303]
   Other proteins in same PDB: d5g5ha2
   automated match to d1n62a2
   complexed with act, cl, csd, fad, fes, gol, iod, mcn, mos, sf4; mutant

Details for d5g5ha1

PDB Entry: 5g5h, 2.3 Å

PDB Description: escherichia coli periplasmic aldehyde oxidase r440h mutant

PDB Compounds: (A:) putative xanthine dehydrogenase yagt iron-sulfur-binding subunit

SCOPe Domain Sequences for d5g5ha1:

Sequence; same for both SEQRES and ATOM records:

>d5g5ha1 d.15.4.0 (A:53-138) automated matches {Escherichia coli [TaxId: 83333]}
aatpapeimpltlkvngkteqlevdtrttlldtlrenlhligtkkgcdhgqcgactvlvn
grrlnacltlavmhqgaeittieglg

Timeline for d5g5ha1:

• d5g5ha1 first appeared in SCOPe 2.06
  
• d5g5ha1 appears in SCOPe 2.07