| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (12 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
| Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88780] (10 PDB entries) |
| Domain d1bmfd3: 1bmf D:82-357 [32329] Other proteins in same PDB: d1bmfa1, d1bmfa2, d1bmfa3, d1bmfb1, d1bmfb2, d1bmfb3, d1bmfc1, d1bmfc2, d1bmfc3, d1bmfd1, d1bmfd2, d1bmfe1, d1bmfe2, d1bmff1, d1bmff2, d1bmfg_ |
PDB Entry: 1bmf (more details), 2.85 Å
SCOP Domain Sequences for d1bmfd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bmfd3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d1bmfd3: