Class b: All beta proteins [48724] (178 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
Protein automated matches [193245] (22 species) not a true protein |
Species Mumps virus [TaxId:11161] [323195] (2 PDB entries) |
Domain d5b2da_: 5b2d A: [323283] automated match to d1e8ub_ complexed with nag, slt, so4 |
PDB Entry: 5b2d (more details), 2.18 Å
SCOPe Domain Sequences for d5b2da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b2da_ b.68.1.1 (A:) automated matches {Mumps virus [TaxId: 11161]} plvndlrfinginkfiiedyathdfsighplnmpsfiptatspngctripsfslgkthwc ythnvinanckdhtssnqyismgilvqtasgypmfktlkiqylsdglnrkscsiatvpdg camycyvstqletddyagsspptqkltllfyndtvtertisptglegnwatlvpgvgsgi yfenklifpayggvlpnstlgvksareffrpvnpynpcsgpqqdldqralrsyfpsyfsn rrvqsaflvcawnqilvtncelvvpsnnqtlmgaegrvllinnrllyyqrstswwpyell yeisftftnsgqssvnmswipiysftrpgsgncsgenvcptacvsgvyldpwpltpyshq sginrnfyftgallnssttrvnptlyvsalnnlkvlapygnqglfasyttttcfqdtgda svycvyimelasnivgefqilpvltrltit
Timeline for d5b2da_: