Lineage for d5chwc1 (5chw C:2-76)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933417Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries)
  8. 2933425Domain d5chwc1: 5chw C:2-76 [323281]
    automated match to d3pseb1
    complexed with gol, so4

Details for d5chwc1

PDB Entry: 5chw (more details), 2.1 Å

PDB Description: structure of isg15 in space group p212121
PDB Compounds: (C:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d5chwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5chwc1 d.15.1.0 (C:2-76) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
awdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlssl
glgpsstvmlvvqns

SCOPe Domain Coordinates for d5chwc1:

Click to download the PDB-style file with coordinates for d5chwc1.
(The format of our PDB-style files is described here.)

Timeline for d5chwc1: