| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
| Protein automated matches [190358] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187279] (33 PDB entries) |
| Domain d5dprc_: 5dpr C: [323266] automated match to d3wanb_ |
PDB Entry: 5dpr (more details), 2.5 Å
SCOPe Domain Sequences for d5dprc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dprc_ d.15.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewvnvgspsdrpfkqrrsfadrckevqqirdqhpskipviierykgekqlpvldktkflv
pdhvnmselvkiirrrlqlnptqaffllvnqhsmvsvstpiadiyeqekdedgflymvya
sqetfgf
Timeline for d5dprc_: