Lineage for d5dpra_ (5dpr A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932720Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2932757Protein automated matches [190358] (6 species)
    not a true protein
  7. 2932770Species Human (Homo sapiens) [TaxId:9606] [187279] (33 PDB entries)
  8. 2932824Domain d5dpra_: 5dpr A: [323263]
    automated match to d3wanb_

Details for d5dpra_

PDB Entry: 5dpr (more details), 2.5 Å

PDB Description: crystal structure of plekhm1 lir-fused human lc3a_2-121
PDB Compounds: (A:) Pleckstrin homology domain-containing family M member 1,Microtubule-associated proteins 1A/1B light chain 3A

SCOPe Domain Sequences for d5dpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dpra_ d.15.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewvnvgspsdrpfkqrrsfadrckevqqirdqhpskipviierykgekqlpvldktkflv
pdhvnmselvkiirrrlqlnptqaffllvnqhsmvsvstpiadiyeqekdedgflymvya
sqet

SCOPe Domain Coordinates for d5dpra_:

Click to download the PDB-style file with coordinates for d5dpra_.
(The format of our PDB-style files is described here.)

Timeline for d5dpra_: