SCOPe 2.08: Domain d5chwa2: 5chw A:77-155

Lineage for d5chwa2 (5chw A:77-155)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries)

8. Domain d5chwa2: 5chw A:77-155 [323261]
   automated match to d3pseb2
   complexed with gol, so4

Details for d5chwa2

PDB Entry: 5chw, 2.1 Å

PDB Description: structure of isg15 in space group p212121

PDB Compounds: (A:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d5chwa2:

Sequence; same for both SEQRES and ATOM records:

>d5chwa2 d.15.1.0 (A:77-155) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
seplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfwlsfegrpmedkellg
eyglkpqctvikhlrlrgg

Timeline for d5chwa2:

• d5chwa2 first appeared in SCOPe 2.06
  
• d5chwa2 appears in SCOPe 2.07