Lineage for d1bmfa3 (1bmf A:95-379)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394452Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (12 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 394505Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)
  7. 394508Species Cow (Bos taurus) [TaxId:9913] [88775] (10 PDB entries)
  8. 394518Domain d1bmfa3: 1bmf A:95-379 [32326]
    Other proteins in same PDB: d1bmfa1, d1bmfa2, d1bmfb1, d1bmfb2, d1bmfc1, d1bmfc2, d1bmfd1, d1bmfd2, d1bmfd3, d1bmfe1, d1bmfe2, d1bmfe3, d1bmff1, d1bmff2, d1bmff3, d1bmfg_

Details for d1bmfa3

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase

SCOP Domain Sequences for d1bmfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmfa3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus)}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOP Domain Coordinates for d1bmfa3:

Click to download the PDB-style file with coordinates for d1bmfa3.
(The format of our PDB-style files is described here.)

Timeline for d1bmfa3: