Lineage for d5abdi_ (5abd I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753887Protein Second domain of the Flt-1 receptor [49188] (1 species)
  7. 2753888Species Human (Homo sapiens) [TaxId:9606] [49189] (6 PDB entries)
  8. 2753894Domain d5abdi_: 5abd I: [323256]
    automated match to d1fltx_
    complexed with cu, na, so4

Details for d5abdi_

PDB Entry: 5abd (more details), 2 Å

PDB Description: crystal structure of vegfr-1 domain 2 in presence of cu
PDB Compounds: (I:) vascular endothelial growth factor receptor 1

SCOPe Domain Sequences for d5abdi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5abdi_ b.1.1.4 (I:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
fiisnatykeiglltceatvnghlyktnylthr

SCOPe Domain Coordinates for d5abdi_:

Click to download the PDB-style file with coordinates for d5abdi_.
(The format of our PDB-style files is described here.)

Timeline for d5abdi_: