Lineage for d1e1rd3 (1e1r D:82-357)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 314141Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (11 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 314233Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)
  7. 314236Species Cow (Bos taurus) [TaxId:9913] [88780] (10 PDB entries)
  8. 314243Domain d1e1rd3: 1e1r D:82-357 [32323]
    Other proteins in same PDB: d1e1ra1, d1e1ra2, d1e1ra3, d1e1rb1, d1e1rb2, d1e1rb3, d1e1rc1, d1e1rc2, d1e1rc3, d1e1rd1, d1e1rd2, d1e1re1, d1e1re2, d1e1rf1, d1e1rf2, d1e1rg_

Details for d1e1rd3

PDB Entry: 1e1r (more details), 2.5 Å

PDB Description: bovine mitochondrial f1-atpase inhibited by mg2+adp and aluminium fluoride

SCOP Domain Sequences for d1e1rd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1rd3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOP Domain Coordinates for d1e1rd3:

Click to download the PDB-style file with coordinates for d1e1rd3.
(The format of our PDB-style files is described here.)

Timeline for d1e1rd3: