SCOPe 2.07: Domain d5dx6b2: 5dx6 B:188-366

Lineage for d5dx6b2 (5dx6 B:188-366)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (14 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [319717] (3 PDB entries)

8. Domain d5dx6b2: 5dx6 B:188-366 [323223]
   Other proteins in same PDB: d5dx6a1, d5dx6a3, d5dx6b1, d5dx6b3, d5dx6b4
   automated match to d1ozha1
   complexed with 5gy, 65s, mg, po4, tpp

Details for d5dx6b2

PDB Entry: 5dx6, 1.75 Å

PDB Description: acetolactate synthase from klebsiella pneumoniae soaked with beta- fluoropyruvate

PDB Compounds: (B:) Acetolactate synthase, catabolic

SCOPe Domain Sequences for d5dx6b2:

Sequence, based on SEQRES records:

>d5dx6b2 c.31.1.0 (B:188-366) automated matches {Klebsiella pneumoniae [TaxId: 573]}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql

Sequence, based on observed residues (ATOM records):

>d5dx6b2 c.31.1.0 (B:188-366) automated matches {Klebsiella pneumoniae [TaxId: 573]}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrel

Timeline for d5dx6b2:

• d5dx6b2 first appeared in SCOPe 2.06
  
• d5dx6b2 appears in the current release, SCOPe 2.08