Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (14 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [319717] (3 PDB entries) |
Domain d5dx6b2: 5dx6 B:188-366 [323223] Other proteins in same PDB: d5dx6a1, d5dx6a3, d5dx6b1, d5dx6b3, d5dx6b4 automated match to d1ozha1 complexed with 5gy, 65s, mg, po4, tpp |
PDB Entry: 5dx6 (more details), 1.75 Å
SCOPe Domain Sequences for d5dx6b2:
Sequence, based on SEQRES records: (download)
>d5dx6b2 c.31.1.0 (B:188-366) automated matches {Klebsiella pneumoniae [TaxId: 573]} qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql
>d5dx6b2 c.31.1.0 (B:188-366) automated matches {Klebsiella pneumoniae [TaxId: 573]} qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrel
Timeline for d5dx6b2: