Lineage for d1e1rb3 (1e1r B:95-379)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847928Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1847984Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)
  7. 1847987Species Cow (Bos taurus) [TaxId:9913] [88775] (15 PDB entries)
    Uniprot P19483
  8. 1848010Domain d1e1rb3: 1e1r B:95-379 [32321]
    Other proteins in same PDB: d1e1ra1, d1e1ra2, d1e1rb1, d1e1rb2, d1e1rc1, d1e1rc2, d1e1rd1, d1e1rd2, d1e1rd3, d1e1re1, d1e1re2, d1e1re3, d1e1rf1, d1e1rf2, d1e1rf3, d1e1rg_
    complexed with adp, af3, anp, mg, po4

Details for d1e1rb3

PDB Entry: 1e1r (more details), 2.5 Å

PDB Description: bovine mitochondrial f1-atpase inhibited by mg2+adp and aluminium fluoride
PDB Compounds: (B:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1e1rb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1rb3 c.37.1.11 (B:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOPe Domain Coordinates for d1e1rb3:

Click to download the PDB-style file with coordinates for d1e1rb3.
(The format of our PDB-style files is described here.)

Timeline for d1e1rb3: