![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries) |
![]() | Domain d5chfb2: 5chf B:77-151 [323206] automated match to d3pseb2 complexed with gol, so4 |
PDB Entry: 5chf (more details), 2.3 Å
SCOPe Domain Sequences for d5chfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5chfb2 d.15.1.0 (B:77-151) automated matches {Mouse (Mus musculus) [TaxId: 10090]} seplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfwlsfegrpmedkellg eyglkpqctvikhlr
Timeline for d5chfb2: