| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
| Protein automated matches [190233] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [189205] (16 PDB entries) |
| Domain d5chwb2: 5chw B:77-152 [323201] automated match to d3pseb2 complexed with gol, so4 |
PDB Entry: 5chw (more details), 2.1 Å
SCOPe Domain Sequences for d5chwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5chwb2 d.15.1.0 (B:77-152) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
seplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfwlsfegrpmedkellg
eyglkpqctvikhlrl
Timeline for d5chwb2: