SCOPe 2.08: Domain d5chwf1: 5chw F:2-76

Lineage for d5chwf1 (5chw F:2-76)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries)

8. Domain d5chwf1: 5chw F:2-76 [323194]
   automated match to d3pseb1
   complexed with gol, so4

Details for d5chwf1

PDB Entry: 5chw, 2.1 Å

PDB Description: structure of isg15 in space group p212121

PDB Compounds: (F:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d5chwf1:

Sequence, based on SEQRES records:

>d5chwf1 d.15.1.0 (F:2-76) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
awdlkvkmlggndflvsvtnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlssl
glgpsstvmlvvqns

Sequence, based on observed residues (ATOM records):

>d5chwf1 d.15.1.0 (F:2-76) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
awdlkvkmndflvsvnsmtvselkkqiaqkigvpafqqrlahqtavlqdgltlsslglgp
sstvmlvvqns

Timeline for d5chwf1:

• d5chwf1 first appeared in SCOPe 2.06
  
• d5chwf1 appears in SCOPe 2.07